Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Centrosomal protein of 170 kDa protein B (C170B), partial, Biotinylated

This Recombinant Human Centrosomal protein of 170 kDa protein B (C170B), partial, Biotinylated spans the amino acid sequence from region 23-73. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Centrosomal protein of 170 kDa protein B; Centrosomal protein 170B; Cep170B; CEP170B FAM68C KIAA0284

UniProt

Q9Y4F5

Expression Region

23-73

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

IFVGREECELMLQSRSVDKQHAVINYDQDRDEHWVKDLGSLNGTFVNDMRI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat ATP synthase protein 8 (MT-ATP8) ELISA Kit
MBS7250890-01 48 Well

Rat ATP synthase protein 8 (MT-ATP8) ELISA Kit

Sign In for Pricing
View Details
Rat ATP synthase protein 8 (MT-ATP8) ELISA Kit
MBS7250890-02 96 Well

Rat ATP synthase protein 8 (MT-ATP8) ELISA Kit

Sign In for Pricing
View Details
Rat ATP synthase protein 8 (MT-ATP8) ELISA Kit
MBS7250890-03 5x 96 Well

Rat ATP synthase protein 8 (MT-ATP8) ELISA Kit

Sign In for Pricing
View Details
Rat ATP synthase protein 8 (MT-ATP8) ELISA Kit
MBS7250890-04 10x 96 Well

Rat ATP synthase protein 8 (MT-ATP8) ELISA Kit

Sign In for Pricing
View Details
Carbohydrate Sulfotransferase 10/CHST10 Overexpression Lysate (Native) - (Dry Ice)
NBL1-09192 0.1 mg

Carbohydrate Sulfotransferase 10/CHST10 Overexpression Lysate (Native) - (Dry Ice)

Sign In for Pricing
View Details
COL5A3 Antibody
E18-9046-2 100 µg -100 µL

COL5A3 Antibody

Sign In for Pricing
View Details