Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protocadherin gamma-B5 (PCDGH), partial, Biotinylated

This Recombinant Human Protocadherin gamma-B5 (PCDGH), partial, Biotinylated spans the amino acid sequence from region 31-687. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Protocadherin gamma-B5; PCDH-gamma-B5; PCDHGB5

UniProt

Q9Y5G0

Expression Region

31-687

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EQIRYRIPEEMPKGSVVGNLATDLGFSVQELPTRKLRVSSEKPYFTVSAESGELLVSSRLDREEICGKKPACALEFEAVAENPLNFYHVNVEIEDINDHTPKFTQNSFELQISESAQPGTRFILEVAEDADIGLNSLQKYKLSLNPSFSLIIKEKQDGSKYPELALEKTLDREQQSYHRLVLTALDGGHPPLSGTTELRIQVTDANDNPPVFNRDVYRVSLRENVPPGTTVLQVSATDQDEGINSEITYSFYRTGQIFSLNSKSGEITTQKKLDFEETKEYSMVVEGRDGGGLVAQCTVEINIQDENDNSPEVTFHSLLEMILENAVPGTLIALIKIHDQDSGENGEVNCQLQGEVPFKIISSSKNSYKLVTDGTLDREQTPEYNVTITATDRGKPPLSSSISVILHIRDVNDNAPVFHQASYLVSVPENNPPGASIAQVCASDLDLGLNGQVSYSIMASDLEPLALASYVSMSAQSGVVFAQRAFDYEQLRTFELTLQARDQGSPALSANVSLRVLVGDRNDNAPRVLYPALGPDGSALFDMVPRAAEPGYLVTKVVAVDADSGHNAWLSYHVLQASEPGLFSLGLRTGEVRTARALGDRDAARQRLLVAVRDGGQPPLSATATLHLVFADSLQEVLPDITDRPVPSDPQAELQFY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human CSNK2B Protein, Untagged, E.coli-2ug
QP11534-2ug 2ug

Recombinant Human CSNK2B Protein, Untagged, E.coli-2ug

Sign In for Pricing
View Details
HPRT (HPRT1) (NM_000194) Human Tagged ORF Clone
RG200462 10 µg

HPRT (HPRT1) (NM_000194) Human Tagged ORF Clone

Sign In for Pricing
View Details
Supervillin Rabbit Polyclonal Antibody
orb158523-01 50 μL

Supervillin Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Supervillin Rabbit Polyclonal Antibody
orb158523-02 100 µL

Supervillin Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Supervillin Rabbit Polyclonal Antibody
orb158523-03 200 µL

Supervillin Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
GQ1b-Ganglioside
GC8688-100ug 100 µg

GQ1b-Ganglioside

Sign In for Pricing
View Details