Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable ATP-dependent RNA helicase DDX49 (DDX49), Biotinylated

This Recombinant Human Probable ATP-dependent RNA helicase DDX49 (DDX49), Biotinylated spans the amino acid sequence from region 1-483. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable ATP-dependent RNA helicase DDX49; EC 3.6.4.13; DEAD box protein 49; DDX49

UniProt

Q9Y6V7

Expression Region

1-483

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MAGFAELGLSSWLVEQCRQLGLKQPTPVQLGCIPAILEGRDCLGCAKTGSGKTAAFVLPILQKLSEDPYGIFCLVLTPTRELAYQIAEQFRVLGKPLGLKDCIIVGGMDMVAQALELSRKPHVVIATPGRLADHLRSSNTFSIKKIRFLVMDEADRLLEQGCTDFTVDLEAILAAVPARRQTLLFSATLTDTLRELQGLATNQPFFWEAQAPVSTVEQLDQRYLLVPEKVKDAYLVHLIQRFQDEHEDWSIIIFTNTCKTCQILCMMLRKFSFPTVALHSMMKQKERFAALAKFKSSIYRILIATDVASRGLDIPTVQVVINHNTPGLPKIYIHRVGRTARAGRQGQAITLVTQYDIHLVHAIEEQIKKKLEEFSVEEAEVLQILTQVNVVRRECEIKLEAAHFDEKKEINKRKQLILEGKDPDLEAKRKAELAKIKQKNRRFKEKVEETLKRQKAGRAGHKGRPPRTPSGSHSGPVPSQGLV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2,3-DPG-13C3 Sodium Salt
TRC-D491993-5MG 5 mg

2,3-DPG-13C3 Sodium Salt

Sign In for Pricing
View Details
Human GALNT1 activation kit by CRISPRa
GA101729 1 Kit

Human GALNT1 activation kit by CRISPRa

Sign In for Pricing
View Details
Baz2a Mouse Gene Knockout Kit (CRISPR)
KN501989 1 Kit

Baz2a Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
DPP1 (CTSC) Rabbit Polyclonal Antibody
TA361322 100 µL

DPP1 (CTSC) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
RFPL2 Antibody
KC-1371-01 50 μL

RFPL2 Antibody

Sign In for Pricing
View Details
RFPL2 Antibody
KC-1371-02 100 µL

RFPL2 Antibody

Sign In for Pricing
View Details