Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Pyrin domain-containing protein 5 (PYDC5), Biotinylated

This Recombinant Human Pyrin domain-containing protein 5 (PYDC5), Biotinylated spans the amino acid sequence from region 1-113. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Pyrin domain-containing protein 5; Pyrin domain-only protein 3; PYDC5 POP3

UniProt

W6CW81

Expression Region

1-113

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MESKYKEILLLTSLDNITDEELDRFKCFLPDEFNIATGKLHTLNSTSSQLDLKRWHGVCSEEDRIFQKLNYMLVAKCLREEQETGICGSPSSARSVSQSRLGLSFHGISGNAC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD20 (B9E9), CF640R conjugate, 0.1mg/mL
BNC400160-500 1x 500 µL

CD20 (B9E9), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (RIV11), CF594 conjugate, 0.1mg/mL
BNC940333-100 1x 100 µL

CD8 (RIV11), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ACTH (Adrenocorticotrophic Hormone) (AH26), CF640R conjugate, 0.1mg/mL
BNC400026-500 1x 500 µL

ACTH (Adrenocorticotrophic Hormone) (AH26), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD46 (122.2), CF640R conjugate, 0.1mg/mL
BNC400175-500 1x 500 µL

CD46 (122.2), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 7 (KRT7/903), CF740 conjugate, 0.1mg/mL
BNC740903-100 1x 100 µL

Cytokeratin 7 (KRT7/903), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Rb1 (Tumor Suppressor Protein) (RB1/2313R), CF594 conjugate, 0.1mg/mL
BNC942313-500 1x 500 µL

Rb1 (Tumor Suppressor Protein) (RB1/2313R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details