Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Pyrin domain-containing protein 5 (PYDC5), Biotinylated

This Recombinant Human Pyrin domain-containing protein 5 (PYDC5), Biotinylated spans the amino acid sequence from region 1-113. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Pyrin domain-containing protein 5; Pyrin domain-only protein 3; PYDC5 POP3

UniProt

W6CW81

Expression Region

1-113

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MESKYKEILLLTSLDNITDEELDRFKCFLPDEFNIATGKLHTLNSTSSQLDLKRWHGVCSEEDRIFQKLNYMLVAKCLREEQETGICGSPSSARSVSQSRLGLSFHGISGNAC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DUX3 Antibody - N-terminal region : Biotin (ARP35847_P050-Biotin)
ARP35847_P050-Biotin 100 µL

DUX3 Antibody - N-terminal region : Biotin (ARP35847_P050-Biotin)

Sign In for Pricing
View Details
CR1L Rabbit Polyclonal Antibody
BT-AP08376-01 20 µL

CR1L Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CR1L Rabbit Polyclonal Antibody
BT-AP08376-02 50 µL

CR1L Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CR1L Rabbit Polyclonal Antibody
BT-AP08376-03 100 µL

CR1L Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Zdhhc21 (NM_001039009) Rat Untagged Clone
RN205819 10 µg

Zdhhc21 (NM_001039009) Rat Untagged Clone

Sign In for Pricing
View Details
SALL2 (Sal-like Protein 2, Zinc Finger Protein 795, Zinc Finger Protein SALL2, Zinc Finger Protein Spalt-2, Sal-2, hSal2, KIAA0360, SAL2, ZNF795, FLJ10414, FLJ55746) (MaxLight 750) discontinued
132955-ML750 100 µL

SALL2 (Sal-like Protein 2, Zinc Finger Protein 795, Zinc Finger Protein SALL2, Zinc Finger Protein Spalt-2, Sal-2, hSal2, KIAA0360, SAL2, ZNF795, FLJ10414, FLJ55746) (MaxLight 750) discontinued

Sign In for Pricing
View Details