Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin lambda variable 4-69 (LV469), Biotinylated

This Recombinant Human Immunoglobulin lambda variable 4-69 (LV469), Biotinylated spans the amino acid sequence from region 21-119. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin lambda variable 4-69 IGLV4-69

UniProt

A0A075B6H9

Expression Region

21-119

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QLVLTQSPSASASLGASVKLTCTLSSGHSSYAIAWHQQQPEKGPRYLMKLNSDGSHSKGDGIPDRFSGSSSGAERYLTISSLQSEDEADYYCQTWGTGI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Monoclonal APAF-1 Antibody (18H2) [DyLight 488]
NBP2-80094G 0.1 mL

Rat Monoclonal APAF-1 Antibody (18H2) [DyLight 488]

Sign In for Pricing
View Details
Mouse Vascular Endothelial Growth Factor Receptor 2 (VEGFR2) ELISA Kit
DLR-VEGFR2-Mu-01 48 Tests

Mouse Vascular Endothelial Growth Factor Receptor 2 (VEGFR2) ELISA Kit

Sign In for Pricing
View Details
Mouse Vascular Endothelial Growth Factor Receptor 2 (VEGFR2) ELISA Kit
DLR-VEGFR2-Mu-02 96 Tests

Mouse Vascular Endothelial Growth Factor Receptor 2 (VEGFR2) ELISA Kit

Sign In for Pricing
View Details
RPS14P10 3'UTR Luciferase Stable Cell Line
TU021976 1.0 mL

RPS14P10 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
C1orf145 Protein Vector (Human) (pPM-C-HA)
14145021 500 ng

C1orf145 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Olfr222 Mouse qPCR Primer Pair (NM_001011789)
MP209762 200 Reactions

Olfr222 Mouse qPCR Primer Pair (NM_001011789)

Sign In for Pricing
View Details