Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin lambda variable 4-69 (LV469), Biotinylated

This Recombinant Human Immunoglobulin lambda variable 4-69 (LV469), Biotinylated spans the amino acid sequence from region 21-119. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin lambda variable 4-69 IGLV4-69

UniProt

A0A075B6H9

Expression Region

21-119

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QLVLTQSPSASASLGASVKLTCTLSSGHSSYAIAWHQQQPEKGPRYLMKLNSDGSHSKGDGIPDRFSGSSSGAERYLTISSLQSEDEADYYCQTWGTGI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse NAD-Dependent Protein Deacylase Sirtuin-5, Mitochondrial (SIRT5) ELISA Kit-Sandwich
EK6F963-01 48 Test

Mouse NAD-Dependent Protein Deacylase Sirtuin-5, Mitochondrial (SIRT5) ELISA Kit-Sandwich

Sign In for Pricing
View Details
Mouse NAD-Dependent Protein Deacylase Sirtuin-5, Mitochondrial (SIRT5) ELISA Kit-Sandwich
EK6F963-02 96 Tests

Mouse NAD-Dependent Protein Deacylase Sirtuin-5, Mitochondrial (SIRT5) ELISA Kit-Sandwich

Sign In for Pricing
View Details
Recombinant Macrococcus caseolyticus Glycerol kinase (glpK)
MBS1140365-01 0.02 mg (E-Coli)

Recombinant Macrococcus caseolyticus Glycerol kinase (glpK)

Sign In for Pricing
View Details
Recombinant Macrococcus caseolyticus Glycerol kinase (glpK)
MBS1140365-02 0.02 mg (Yeast)

Recombinant Macrococcus caseolyticus Glycerol kinase (glpK)

Sign In for Pricing
View Details
Recombinant Macrococcus caseolyticus Glycerol kinase (glpK)
MBS1140365-03 0.1 mg (E-Coli)

Recombinant Macrococcus caseolyticus Glycerol kinase (glpK)

Sign In for Pricing
View Details
Recombinant Macrococcus caseolyticus Glycerol kinase (glpK)
MBS1140365-04 0.1 mg (Yeast)

Recombinant Macrococcus caseolyticus Glycerol kinase (glpK)

Sign In for Pricing
View Details