Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin lambda variable 4-69 (LV469), Biotinylated

This Recombinant Human Immunoglobulin lambda variable 4-69 (LV469), Biotinylated spans the amino acid sequence from region 21-119. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin lambda variable 4-69 IGLV4-69

UniProt

A0A075B6H9

Expression Region

21-119

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QLVLTQSPSASASLGASVKLTCTLSSGHSSYAIAWHQQQPEKGPRYLMKLNSDGSHSKGDGIPDRFSGSSSGAERYLTISSLQSEDEADYYCQTWGTGI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-TWF1 Antibody Picoband®, Dylight594 Conjugate
A07004-1-Dylight594 100 µg

Anti-TWF1 Antibody Picoband®, Dylight594 Conjugate

Sign In for Pricing
View Details
Lentiviral mouse Lrrc36 shRNA (UAS) - Lentiviral mouse Lrrc36 shRNA (UAS, RFP) plasmid
GTR15243541 1 Vial

Lentiviral mouse Lrrc36 shRNA (UAS) - Lentiviral mouse Lrrc36 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
Anti-SKAP1 Antibody
A05514 100 µL

Anti-SKAP1 Antibody

Sign In for Pricing
View Details
Mpzl1 AAV siRNA Pooled Vector
30380164 1.0 µg

Mpzl1 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
DPCD Antibody
orb2809303 100 µL

DPCD Antibody

Sign In for Pricing
View Details
Human TSHB/Thyrotropin subunit beta ELISA Kit
EK00066E 96 Tests

Human TSHB/Thyrotropin subunit beta ELISA Kit

Sign In for Pricing
View Details