Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin lambda variable 8-61 (LV861), Biotinylated

This Recombinant Human Immunoglobulin lambda variable 8-61 (LV861), Biotinylated spans the amino acid sequence from region 25-122. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin lambda variable 8-61 IGLV8-61

UniProt

A0A075B6I0

Expression Region

25-122

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QTVVTQEPSFSVSPGGTVTLTCGLSSGSVSTSYYPSWYQQTPGQAPRTLIYSTNTRSSGVPDRFSGSILGNKAALTITGAQADDESDYYCVLYMGSGI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RXR alpha (Retinoid X Receptor alpha, Retinoic Acid Receptor RXRalpha, RXRa, RXRalpha1, FLJ16020, FLJ16733, MGC102720, Nuclear Receptor Subfamily 2 Group B Member 1, NR2B1) (FITC) discontinued
R9985-02C-FITC 100 µL

RXR alpha (Retinoid X Receptor alpha, Retinoic Acid Receptor RXRalpha, RXRa, RXRalpha1, FLJ16020, FLJ16733, MGC102720, Nuclear Receptor Subfamily 2 Group B Member 1, NR2B1) (FITC) discontinued

Sign In for Pricing
View Details
Mmu-miR-292b-3p miRNA Antagomir
orb1911909-01 10 nmol

Mmu-miR-292b-3p miRNA Antagomir

Sign In for Pricing
View Details
Mmu-miR-292b-3p miRNA Antagomir
orb1911909-02 20 nmol

Mmu-miR-292b-3p miRNA Antagomir

Sign In for Pricing
View Details
ZNF671 ORF Vector (Human) (pORF)
51715011 1.0 µg DNA

ZNF671 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
TIMM8A Protein Vector (Human) (pPM-C-HA)
PV042123 500 ng

TIMM8A Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Saa1-set siRNA/shRNA/RNAi Lentivector (Mouse)
42960094 4x 500 ng

Saa1-set siRNA/shRNA/RNAi Lentivector (Mouse)

Sign In for Pricing
View Details