Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin lambda variable 4-60 (LV460), Biotinylated

This Recombinant Human Immunoglobulin lambda variable 4-60 (LV460), Biotinylated spans the amino acid sequence from region 22-120. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin lambda variable 4-60 IGLV4-60

UniProt

A0A075B6I1

Expression Region

22-120

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QPVLTQSSSASASLGSSVKLTCTLSSGHSSYIIAWHQQQPGKAPRYLMKLEGSGSYNKGSGVPDRFSGSSSGADRYLTISNLQFEDEADYYCETWDSNT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CEPA sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K0435407 1.0 µg DNA

CEPA sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
LXR beta (NR1H2) Rabbit Polyclonal Antibody
TA333896 100 µL

LXR beta (NR1H2) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Mouse Monoclonal IL-22 Antibody (8F11E2) - Azide and BSA Free
NBP2-80805 0.1 mg

Mouse Monoclonal IL-22 Antibody (8F11E2) - Azide and BSA Free

Sign In for Pricing
View Details
Rabbit Anti-Human NAF1 pAb
PA11262-01 50 μL

Rabbit Anti-Human NAF1 pAb

Sign In for Pricing
View Details
Rabbit Anti-Human NAF1 pAb
PA11262-02 100 μL

Rabbit Anti-Human NAF1 pAb

Sign In for Pricing
View Details
Sfr1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)
K7590707 1.0 µg DNA

Sfr1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details