Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin lambda variable 4-60 (LV460), Biotinylated

This Recombinant Human Immunoglobulin lambda variable 4-60 (LV460), Biotinylated spans the amino acid sequence from region 22-120. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin lambda variable 4-60 IGLV4-60

UniProt

A0A075B6I1

Expression Region

22-120

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QPVLTQSSSASASLGSSVKLTCTLSSGHSSYIIAWHQQQPGKAPRYLMKLEGSGSYNKGSGVPDRFSGSSSGADRYLTISNLQFEDEADYYCETWDSNT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Canine Interleukin 22 (IL-22) ELISA Kit
EIA05905Ca 1 Kit

Canine Interleukin 22 (IL-22) ELISA Kit

Sign In for Pricing
View Details
GAPDH Monoclonal Antibody
CSB-MA072309 100 µL

GAPDH Monoclonal Antibody

Sign In for Pricing
View Details
2-methyl-N- (1- (pyrazin-2-yl) cyclobutyl) propane-2-sulfinamide
OR1075701-01 100 mg

2-methyl-N- (1- (pyrazin-2-yl) cyclobutyl) propane-2-sulfinamide

Sign In for Pricing
View Details
2-methyl-N- (1- (pyrazin-2-yl) cyclobutyl) propane-2-sulfinamide
OR1075701-02 250 mg

2-methyl-N- (1- (pyrazin-2-yl) cyclobutyl) propane-2-sulfinamide

Sign In for Pricing
View Details
2-methyl-N- (1- (pyrazin-2-yl) cyclobutyl) propane-2-sulfinamide
OR1075701-03 1 g

2-methyl-N- (1- (pyrazin-2-yl) cyclobutyl) propane-2-sulfinamide

Sign In for Pricing
View Details
Human MPC1 (Mitochondrial Pyruvate Carrier Protein 1) ELISA Kit
EK246414 96 Well

Human MPC1 (Mitochondrial Pyruvate Carrier Protein 1) ELISA Kit

Sign In for Pricing
View Details