Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin lambda variable 4-60 (LV460), Biotinylated

This Recombinant Human Immunoglobulin lambda variable 4-60 (LV460), Biotinylated spans the amino acid sequence from region 22-120. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin lambda variable 4-60 IGLV4-60

UniProt

A0A075B6I1

Expression Region

22-120

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QPVLTQSSSASASLGSSVKLTCTLSSGHSSYIIAWHQQQPGKAPRYLMKLEGSGSYNKGSGVPDRFSGSSSGADRYLTISNLQFEDEADYYCETWDSNT

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Inactive phospholipase C-like protein 1, PLCL1 ELISA KIT
ELI-37305h 96 Tests

Human Inactive phospholipase C-like protein 1, PLCL1 ELISA KIT

Sign In for Pricing
View Details
PVRL3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K1762306 1.0 µg DNA

PVRL3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
CTRB2 Rabbit Polyclonal Antibody
orb2954799-01 50 µg

CTRB2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CTRB2 Rabbit Polyclonal Antibody
orb2954799-02 100 µg

CTRB2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ACY3 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K0040105 3x 1.0 µg

ACY3 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
IL8 Protein Vector (Human) (pPB-C-His)
PV021425 500 ng

IL8 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details