Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin lambda variable 4-60 (LV460), Biotinylated

This Recombinant Human Immunoglobulin lambda variable 4-60 (LV460), Biotinylated spans the amino acid sequence from region 22-120. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin lambda variable 4-60 IGLV4-60

UniProt

A0A075B6I1

Expression Region

22-120

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QPVLTQSSSASASLGSSVKLTCTLSSGHSSYIIAWHQQQPGKAPRYLMKLEGSGSYNKGSGVPDRFSGSSSGADRYLTISNLQFEDEADYYCETWDSNT

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD56 / NCAM (123C3.D5 + 123A8), CF647 conjugate, 0.1mg/mL
BNC470693-500 1x 500 µL

CD56 / NCAM (123C3.D5 + 123A8), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HEYL (Hairy/Enhancer-of-Split Related with YRPW Motif-like, HRT3, MGC12623, bHLHb33) (FITC)
MBS6175636-01 0.1 mL

HEYL (Hairy/Enhancer-of-Split Related with YRPW Motif-like, HRT3, MGC12623, bHLHb33) (FITC)

Sign In for Pricing
View Details
HEYL (Hairy/Enhancer-of-Split Related with YRPW Motif-like, HRT3, MGC12623, bHLHb33) (FITC)
MBS6175636-02 5x 0.1 mL

HEYL (Hairy/Enhancer-of-Split Related with YRPW Motif-like, HRT3, MGC12623, bHLHb33) (FITC)

Sign In for Pricing
View Details
Wdr62 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
K6667105 3x 1.0 µg

Wdr62 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
Zfp180 Protein Vector (Mouse) (pPM-C-His)
PV248937 500 ng

Zfp180 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
SLC25A10 Antibody Blocking peptide
orb1443735 500 µg

SLC25A10 Antibody Blocking peptide

Sign In for Pricing
View Details