Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin lambda variable 10-54 (LVX54), Biotinylated

This Recombinant Human Immunoglobulin lambda variable 10-54 (LVX54), Biotinylated spans the amino acid sequence from region 22-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin lambda variable 10-54 IGLV10-54

UniProt

A0A075B6I4

Expression Region

22-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GLTQPPSVSKGLRQTATLTCTGNSNIVGNQGAAWLQQHQGHPPKLLSYRNNNRPSGISERFSASRSGNTASLTITGLQPEDEADYYCSALDSSLSA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LMA1L, ID (LMAN1L, ERGL, Protein ERGIC-53-like, ERGIC53-like protein, Lectin mannose-binding 1-like) (MaxLight 490) discontinued
037827-ML490 100 µL

LMA1L, ID (LMAN1L, ERGL, Protein ERGIC-53-like, ERGIC53-like protein, Lectin mannose-binding 1-like) (MaxLight 490) discontinued

Sign In for Pricing
View Details
FAM66B sgRNA CRISPR Lentivector set (Human)
K0727501 3x 1.0 µg

FAM66B sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
Stratifin
335919 100 µL

Stratifin

Sign In for Pricing
View Details
C2cd3 (NM_001191602) Rat Tagged ORF Clone
RR217760 10 µg

C2cd3 (NM_001191602) Rat Tagged ORF Clone

Sign In for Pricing
View Details
Kv7.2/KCNQ2 K+ channel Mouse Monoclonal Antibody
orb2958369-01 50 µg

Kv7.2/KCNQ2 K+ channel Mouse Monoclonal Antibody

Sign In for Pricing
View Details
Kv7.2/KCNQ2 K+ channel Mouse Monoclonal Antibody
orb2958369-02 100 µg

Kv7.2/KCNQ2 K+ channel Mouse Monoclonal Antibody

Sign In for Pricing
View Details