Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional immunoglobulin lambda variable 1-50 (LV150), Biotinylated

This Recombinant Human Probable non-functional immunoglobulin lambda variable 1-50 (LV150), Biotinylated spans the amino acid sequence from region 20-118. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional immunoglobulin lambda variable 1-50 IGLV1-50

UniProt

A0A075B6I6

Expression Region

20-118

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QSVLTQPPSVSGAPGQRVTISCTGSSSNIGAGYVVHWYQQLPGTAPKLLIYGNSNRPSGVPDQFSGSKSGTSASLAITGLQSEDEADYYCKAWDNSLNA

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TMPRSS13 (Transmembrane Protease Serine 13, Membrane-type Mosaic Serine Protease, Mosaic Serine Protease, MSP, TMPRSS11, MSPL, MSPS) (MaxLight 750) discontinued
134522-ML750 100 µL

TMPRSS13 (Transmembrane Protease Serine 13, Membrane-type Mosaic Serine Protease, Mosaic Serine Protease, MSP, TMPRSS11, MSPL, MSPS) (MaxLight 750) discontinued

Sign In for Pricing
View Details
Scand1 (NM_020255) Mouse Tagged ORF Clone
MR200922 10 µg

Scand1 (NM_020255) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Polyclonal SLC35D3 Antibody
APR10097G 0.1 mg

Polyclonal SLC35D3 Antibody

Sign In for Pricing
View Details
Rabbit Monoclonal GSTM2 Antibody (011) [Janelia Fluor 549]
NBP2-90041JF549 0.1 mL

Rabbit Monoclonal GSTM2 Antibody (011) [Janelia Fluor 549]

Sign In for Pricing
View Details
Human Neuropeptide W,NPW ELISA KIT
JOT-EK7526Hu 96 wells

Human Neuropeptide W,NPW ELISA KIT

Sign In for Pricing
View Details
Ms4a4d Mouse shRNA Lentiviral Particle (Locus ID 66607)
TL510430V 500 µL Each

Ms4a4d Mouse shRNA Lentiviral Particle (Locus ID 66607)

Sign In for Pricing
View Details