Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional immunoglobulin lambda variable 1-50 (LV150), Biotinylated

This Recombinant Human Probable non-functional immunoglobulin lambda variable 1-50 (LV150), Biotinylated spans the amino acid sequence from region 20-118. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional immunoglobulin lambda variable 1-50 IGLV1-50

UniProt

A0A075B6I6

Expression Region

20-118

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QSVLTQPPSVSGAPGQRVTISCTGSSSNIGAGYVVHWYQQLPGTAPKLLIYGNSNRPSGVPDQFSGSKSGTSASLAITGLQSEDEADYYCKAWDNSLNA

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

mogroside ⅢA1
N2008-10 10 mg

mogroside ⅢA1

Sign In for Pricing
View Details
MAPK8 Antibody
A28165-100UL 100 µL

MAPK8 Antibody

Sign In for Pricing
View Details
IL1RL2 (Interleukin 1 Receptor-like 2, IL1R-rp2, IL1RRP2) (HRP)
247560-HRP 100 µL

IL1RL2 (Interleukin 1 Receptor-like 2, IL1R-rp2, IL1RRP2) (HRP)

Sign In for Pricing
View Details
Anti-PI3K p110 Delta PIK3CD Antibody
A02269 100 µL

Anti-PI3K p110 Delta PIK3CD Antibody

Sign In for Pricing
View Details
PTK7
527411-01 100 µL

PTK7

Sign In for Pricing
View Details
PTK7
527411-02 200 µL

PTK7

Sign In for Pricing
View Details