Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin lambda variable 7-46 (LV746), Biotinylated

This Recombinant Human Immunoglobulin lambda variable 7-46 (LV746), Biotinylated spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin lambda variable 7-46 IGLV7-46

UniProt

A0A075B6I9

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QAVVTQEPSLTVSPGGTVTLTCGSSTGAVTSGHYPYWFQQKPGQAPRTLIYDTSNKHSWTPARFSGSLLGGKAALTLLGAQPEDEAEYYCLLSYSGAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPS14 Antibody, Biotin conjugated
CSB-PA04255D0Rb-01 50 µg

RPS14 Antibody, Biotin conjugated

Sign In for Pricing
View Details
RPS14 Antibody, Biotin conjugated
CSB-PA04255D0Rb-02 100 µg

RPS14 Antibody, Biotin conjugated

Sign In for Pricing
View Details
Anti-Human IFNA1/Interferon alpha-D Antibody (SAA0399), APC
HF565137-01 1 Each

Anti-Human IFNA1/Interferon alpha-D Antibody (SAA0399), APC

Sign In for Pricing
View Details
Anti-Human IFNA1/Interferon alpha-D Antibody (SAA0399), APC
HF565137-02 100 Tests

Anti-Human IFNA1/Interferon alpha-D Antibody (SAA0399), APC

Sign In for Pricing
View Details
Diamine Oxidase Activity Assay
AKR-MA-0262 100 Well

Diamine Oxidase Activity Assay

Sign In for Pricing
View Details
Z-cis-4-aminocyclohexane acetic acid 98+% (HPLC)
242650-01 100 mg

Z-cis-4-aminocyclohexane acetic acid 98+% (HPLC)

Sign In for Pricing
View Details