Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin lambda variable 5-37 (LV537), Biotinylated

This Recombinant Human Immunoglobulin lambda variable 5-37 (LV537), Biotinylated spans the amino acid sequence from region 20-123. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin lambda variable 5-37 IGLV5-37

UniProt

A0A075B6J1

Expression Region

20-123

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QPVLTQPPSSSASPGESARLTCTLPSDINVGSYNIYWYQQKPGSPPRYLLYYYSDSDKGQGSGVPSRFSGSKDASANTGILLISGLQSEDEADYYCMIWPSNAS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Asah2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
K7087005 3x 1.0 µg

Asah2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
Topoisomerase IIα-IN-11
orb3135119-01 50 mg

Topoisomerase IIα-IN-11

Sign In for Pricing
View Details
Topoisomerase IIα-IN-11
orb3135119-02 10 mg

Topoisomerase IIα-IN-11

Sign In for Pricing
View Details
Anti-Cytochrome C (CYCS)
FY-AB54433-01 1 mL

Anti-Cytochrome C (CYCS)

Sign In for Pricing
View Details
Anti-Cytochrome C (CYCS)
FY-AB54433-02 100 µL

Anti-Cytochrome C (CYCS)

Sign In for Pricing
View Details
Anti-Cytochrome C (CYCS)
FY-AB54433-03 200 µL

Anti-Cytochrome C (CYCS)

Sign In for Pricing
View Details