Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional immunoglobulin lambda variable 2-33 (LV233), Biotinylated

This Recombinant Human Probable non-functional immunoglobulin lambda variable 2-33 (LV233), Biotinylated spans the amino acid sequence from region 20-118. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional immunoglobulin lambda variable 2-33 IGLV2-33

UniProt

A0A075B6J2

Expression Region

20-118

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QSALTQPPFVSGAPGQSVTISCTGTSSDVGDYDHVFWYQKRLSTTSRLLIYNVNTRPSGISDLFSGSKSGNMASLTISGLKSEVEANYHCSLYSSSYTF

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-CBL (Tyr674) Antibody
AF3225-01 100 µL

Phospho-CBL (Tyr674) Antibody

Sign In for Pricing
View Details
Phospho-CBL (Tyr674) Antibody
AF3225-02 200 µL

Phospho-CBL (Tyr674) Antibody

Sign In for Pricing
View Details
Recombinant Human LGALS1 Protein
E30P00191A 50 µg

Recombinant Human LGALS1 Protein

Sign In for Pricing
View Details
Anti-DUT Antibody Picoband®, APC Conjugate
PA1030-1-APC 100 µg/Vial

Anti-DUT Antibody Picoband®, APC Conjugate

Sign In for Pricing
View Details
TBX5 Protein Vector (Rat) (pPM-C-HA)
PV310056 500 ng

TBX5 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
REG3B siRNA (Mouse)
orb1846334-01 15 nmol

REG3B siRNA (Mouse)

Sign In for Pricing
View Details