Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional immunoglobulin lambda variable 2-33 (LV233), Biotinylated

This Recombinant Human Probable non-functional immunoglobulin lambda variable 2-33 (LV233), Biotinylated spans the amino acid sequence from region 20-118. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional immunoglobulin lambda variable 2-33 IGLV2-33

UniProt

A0A075B6J2

Expression Region

20-118

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QSALTQPPFVSGAPGQSVTISCTGTSSDVGDYDHVFWYQKRLSTTSRLLIYNVNTRPSGISDLFSGSKSGNMASLTISGLKSEVEANYHCSLYSSSYTF

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-CD226 (Ser329) Colorimetric Cell-Based ELISA Kit (OKAG01759)
OKAG01759 2x 96 Well

Phospho-CD226 (Ser329) Colorimetric Cell-Based ELISA Kit (OKAG01759)

Sign In for Pricing
View Details
Human TCC C5b-9(Terminal Complement Complex C5b-9) ELISA Kit
EKF60447-01 48 Tests

Human TCC C5b-9(Terminal Complement Complex C5b-9) ELISA Kit

Sign In for Pricing
View Details
Human TCC C5b-9(Terminal Complement Complex C5b-9) ELISA Kit
EKF60447-02 96 Tests

Human TCC C5b-9(Terminal Complement Complex C5b-9) ELISA Kit

Sign In for Pricing
View Details
Human TCC C5b-9(Terminal Complement Complex C5b-9) ELISA Kit
EKF60447-03 5x 96 Tests

Human TCC C5b-9(Terminal Complement Complex C5b-9) ELISA Kit

Sign In for Pricing
View Details
KIF25 Peptide - N-terminal region
orb2020121 100 µg

KIF25 Peptide - N-terminal region

Sign In for Pricing
View Details
Fabric mantle for Globe separatory funnel 500ml, 180W, 230V, CE
100A O861CE 1 Each

Fabric mantle for Globe separatory funnel 500ml, 180W, 230V, CE

Sign In for Pricing
View Details