Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin lambda variable 3-22 (LV322), Biotinylated

This Recombinant Human Immunoglobulin lambda variable 3-22 (LV322), Biotinylated spans the amino acid sequence from region 21-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin lambda variable 3-22 IGLV3-22

UniProt

A0A075B6J6

Expression Region

21-115

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

YELTQLPSVSVSPGQTARITCSGDVLGENYADWYQQKPGQAPELVIYEDSERYPGIPERFSGSTSGNTTTLTISRVLTEDEADYYCLSGDEDNPS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Synaptophysin Antibody
MBS540300-01 0.1 mg

Synaptophysin Antibody

Sign In for Pricing
View Details
Synaptophysin Antibody
MBS540300-02 5x 0.1 mg

Synaptophysin Antibody

Sign In for Pricing
View Details
GRO beta protein
30R-AG030 0.025 mg

GRO beta protein

Sign In for Pricing
View Details
TMEM35 (TMEM35A) (NM_021637) Human Over-expression Lysate
E45H11503-2 20 µg

TMEM35 (TMEM35A) (NM_021637) Human Over-expression Lysate

Sign In for Pricing
View Details
RPL36AP8 ORF Vector (Human) (pORF)
ORF030757 1.0 µg DNA

RPL36AP8 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
SCFD1 Protein (N-His, Human)
P508154 100 µg

SCFD1 Protein (N-His, Human)

Sign In for Pricing
View Details