Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin lambda variable 3-16 (LV316), Biotinylated

This Recombinant Human Immunoglobulin lambda variable 3-16 (LV316), Biotinylated spans the amino acid sequence from region 20-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin lambda variable 3-16 IGLV3-16

UniProt

A0A075B6K0

Expression Region

20-115

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

SYELTQPPSVSVSLGQMARITCSGEALPKKYAYWYQQKPGQFPVLVIYKDSERPSGIPERFSGSSSGTIVTLTISGVQAEDEADYYCLSADSSGTY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Apbb1 (BC048395) Mouse Tagged Lenti ORF Clone
MR206000L3 10 µg

Apbb1 (BC048395) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Rat Olfactory receptor 8B8 (OR8B8) ELISA Kit
GTR10345284 96 Well

Rat Olfactory receptor 8B8 (OR8B8) ELISA Kit

Sign In for Pricing
View Details
Anti-IL1A/IL1F1 Antibody (R2X45)
RHB95501 100 μg

Anti-IL1A/IL1F1 Antibody (R2X45)

Sign In for Pricing
View Details
MLLT6-set siRNA/shRNA/RNAi Lentivector (Human)
30210091 4x 500 ng

MLLT6-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
LIPI (Lipase Member I, LIPI, 311-, Cancer/Testis antigen 17, CT17, LPD Lipase, Membrane-Associated Phosphatidic Acid-Selective PhosphoLipase A1-beta, mPA-PLA1 beta, LIPI, LPDL) (APC)
MBS6456955-01 0.2 mL

LIPI (Lipase Member I, LIPI, 311-, Cancer/Testis antigen 17, CT17, LPD Lipase, Membrane-Associated Phosphatidic Acid-Selective PhosphoLipase A1-beta, mPA-PLA1 beta, LIPI, LPDL) (APC)

Sign In for Pricing
View Details
LIPI (Lipase Member I, LIPI, 311-, Cancer/Testis antigen 17, CT17, LPD Lipase, Membrane-Associated Phosphatidic Acid-Selective PhosphoLipase A1-beta, mPA-PLA1 beta, LIPI, LPDL) (APC)
MBS6456955-02 5x 0.2 mL

LIPI (Lipase Member I, LIPI, 311-, Cancer/Testis antigen 17, CT17, LPD Lipase, Membrane-Associated Phosphatidic Acid-Selective PhosphoLipase A1-beta, mPA-PLA1 beta, LIPI, LPDL) (APC)

Sign In for Pricing
View Details