Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin lambda variable 3-16 (LV316), Biotinylated

This Recombinant Human Immunoglobulin lambda variable 3-16 (LV316), Biotinylated spans the amino acid sequence from region 20-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin lambda variable 3-16 IGLV3-16

UniProt

A0A075B6K0

Expression Region

20-115

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

SYELTQPPSVSVSLGQMARITCSGEALPKKYAYWYQQKPGQFPVLVIYKDSERPSGIPERFSGSSSGTIVTLTISGVQAEDEADYYCLSADSSGTY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-CD4 Recombinant Monoclonal Antibody [BLR167J]
A700-167 100 µL (50+ Tests)

Rabbit anti-CD4 Recombinant Monoclonal Antibody [BLR167J]

Sign In for Pricing
View Details
Actin -BIOTIN, Antibody
GWB-B5B710 0.02 mg

Actin -BIOTIN, Antibody

Sign In for Pricing
View Details
Phospho-KAT5 (Ser86) Polyclonal Antibody, RBITC Conjugated
bs-17096R-RBITC-TR 20 µL

Phospho-KAT5 (Ser86) Polyclonal Antibody, RBITC Conjugated

Sign In for Pricing
View Details
Stk16 (BC005703) Mouse Tagged ORF Clone
MR202684 10 µg

Stk16 (BC005703) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Lentiviral mouse Pak6 shRNA (UAS) - Lentiviral mouse Pak6 shRNA (UAS, iRFP) (25)
GTR15269966 1 Vial

Lentiviral mouse Pak6 shRNA (UAS) - Lentiviral mouse Pak6 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
eIF5A2 Recombinant Protein Antigen
NBP1-85943PEP 0.1 mL

eIF5A2 Recombinant Protein Antigen

Sign In for Pricing
View Details