Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional T cell receptor gamma variable 11 (TVG11), Biotinylated

This Recombinant Human Probable non-functional T cell receptor gamma variable 11 (TVG11), Biotinylated spans the amino acid sequence from region 19-119. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional T cell receptor gamma variable 11 TRGV11

UniProt

A0A075B6L2

Expression Region

19-119

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QLEQPEISISRPANKSAHISWKASIQGFSSKIIHWYWQKPNKGLEYLLHVFLTISAQDCSGGKTKKLEVSKNAHTSTSTLKIKFLEKEDEVVYHCACWIRH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C-Myc Oncoprotein (MYC2895R), CF488A conjugate, 0.1mg/mL
BNC882895-100 1x 100 µL

C-Myc Oncoprotein (MYC2895R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TLE1 (Synovial Sarcoma Marker) (TLE1/2062), CF640R conjugate, 0.1mg/mL
BNC402062-500 1x 500 µL

TLE1 (Synovial Sarcoma Marker) (TLE1/2062), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
AIF1 / Iba1 (Microglia Marker) (rAIF1/1909), CF640R conjugate, 0.1mg/mL
BNC402346-500 1x 500 µL

AIF1 / Iba1 (Microglia Marker) (rAIF1/1909), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
AKT1 (Prognostic Marker for Neuroendocrine Tumors) (AKT1/2552), CF594 conjugate, 0.1mg/mL
BNC942552-100 1x 100 µL

AKT1 (Prognostic Marker for Neuroendocrine Tumors) (AKT1/2552), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Secretory Component / ECM1 (ECM1/2889R), CF405S conjugate, 0.1mg/mL
BNC042889-500 1x 500 µL

Secretory Component / ECM1 (ECM1/2889R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 18 (C-04), CF740 conjugate, 0.1mg/mL
BNC740041-500 1x 500 µL

Cytokeratin 18 (C-04), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details