Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional T cell receptor beta variable 7-3 (TVB73), Biotinylated

This Recombinant Human Probable non-functional T cell receptor beta variable 7-3 (TVB73), Biotinylated spans the amino acid sequence from region 22-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional T cell receptor beta variable 7-3 TRBV7-3

UniProt

A0A075B6L6

Expression Region

22-115

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVSQTPSNKVTEKGKDVELRCDPISGHTALYWYRQSLGQGPEFLIYFQGTGAADDSGLPKDRFFAVRPEGSVSTLKIQRTEQGDSAAYLRASSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD33 (C33/69), 1mg/mL
BNUM0069-50 1x 50 µL

CD33 (C33/69), 1mg/mL

Sign In for Pricing
View Details
NAPE PLD (NAPEPLD) (NM_001122838) Human Over-expression Lysate
LC426574 20 µg

NAPE PLD (NAPEPLD) (NM_001122838) Human Over-expression Lysate

Sign In for Pricing
View Details
FAM59A (GAREM1) Human Gene Knockout Kit (CRISPR)
KN423755 1 Kit

FAM59A (GAREM1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CDK6 pTyr24 Rabbit Polyclonal Antibody
AP08040PU-N 100 µL

CDK6 pTyr24 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Upamostat
TRC-U220220-500MG 500 mg

Upamostat

Sign In for Pricing
View Details
DUSP27 (DUPD1) (NM_001003892) Human Over-expression Lysate
LY424030 100 µg

DUSP27 (DUPD1) (NM_001003892) Human Over-expression Lysate

Sign In for Pricing
View Details