Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional T cell receptor beta variable 7-3 (TVB73), Biotinylated

This Recombinant Human Probable non-functional T cell receptor beta variable 7-3 (TVB73), Biotinylated spans the amino acid sequence from region 22-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional T cell receptor beta variable 7-3 TRBV7-3

UniProt

A0A075B6L6

Expression Region

22-115

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVSQTPSNKVTEKGKDVELRCDPISGHTALYWYRQSLGQGPEFLIYFQGTGAADDSGLPKDRFFAVRPEGSVSTLKIQRTEQGDSAAYLRASSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

N-Octanoylglycine-13C2,15N
TRC-O239737-1MG 1 mg

N-Octanoylglycine-13C2,15N

Sign In for Pricing
View Details
Lentiviral mouse Apoc3 shRNA (UAS) - Lentiviral mouse Apoc3 shRNA (UAS) (25)
GTR15236669 1 Vial

Lentiviral mouse Apoc3 shRNA (UAS) - Lentiviral mouse Apoc3 shRNA (UAS) (25)

Sign In for Pricing
View Details
Human ACTRT3 Pre-designed siRNA Set A
SI000235A 1 Each

Human ACTRT3 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Endothelial nitric oxide Synthase (eNOS) Canine ELISA Kit
D1724 96 Tests

Endothelial nitric oxide Synthase (eNOS) Canine ELISA Kit

Sign In for Pricing
View Details
4-Aminobenzoic acid
MBS3841313-01 500 mg

4-Aminobenzoic acid

Sign In for Pricing
View Details
4-Aminobenzoic acid
MBS3841313-02 1 g

4-Aminobenzoic acid

Sign In for Pricing
View Details