Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 24-1 (TVBX1), Biotinylated

This Recombinant Human T cell receptor beta variable 24-1 (TVBX1), Biotinylated spans the amino acid sequence from region 22-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 24-1 TRBV24-1

UniProt

A0A075B6N3

Expression Region

22-115

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

DVTQTPRNRITKTGKRIMLECSQTKGHDRMYWYRQDPGLGLQLIYYSFDVKDINKGEISDGYSVSRQAQAKFSLSLESAIPNQTALYFCATSDL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-FOLR2 Mouse Monoclonal Antibody [Clone ID: OTI4G6]
M04574-2 100 µL

Anti-FOLR2 Mouse Monoclonal Antibody [Clone ID: OTI4G6]

Sign In for Pricing
View Details
CTSE Antibody
MBS7047973-01 0.05 mg

CTSE Antibody

Sign In for Pricing
View Details
CTSE Antibody
MBS7047973-02 0.1 mg

CTSE Antibody

Sign In for Pricing
View Details
CTSE Antibody
MBS7047973-03 5x 0.1 mg

CTSE Antibody

Sign In for Pricing
View Details
ACE2 Rabbit pAb, IRDye 800CW conjugated
orb2843678 100 µL

ACE2 Rabbit pAb, IRDye 800CW conjugated

Sign In for Pricing
View Details
Elongation Factor Ts Rabbit mAb Antibody
orb3014629 100 µL

Elongation Factor Ts Rabbit mAb Antibody

Sign In for Pricing
View Details