Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 25-1 (TVBY1), Biotinylated

This Recombinant Human T cell receptor beta variable 25-1 (TVBY1), Biotinylated spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 25-1 TRBV25-1

UniProt

A0A075B6N4

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

DIYQTPRYLVIGTGKKITLECSQTMGHDKMYWYQQDPGMELHLIHYSYGVNSTEKGDLSSESTVSRIRTEHFPLTLESARPSHTSQYLCASSE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bisphenol AP-13C6
TRC-B519487-1MG 1 mg

Bisphenol AP-13C6

Sign In for Pricing
View Details
Ltc4s (BC028760) Mouse Tagged ORF Clone
MG200453 10 µg

Ltc4s (BC028760) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Geminin (GMNN) (NM_015895) Human Over-expression Lysate
LC402469 20 µg

Geminin (GMNN) (NM_015895) Human Over-expression Lysate

Sign In for Pricing
View Details
Adenosine A1 Receptor Recombinant Rabbit Monoclonal Antibody [JE31-35]
HA721393 100 µL

Adenosine A1 Receptor Recombinant Rabbit Monoclonal Antibody [JE31-35]

Sign In for Pricing
View Details
GPAT4 (N-term) Rabbit Polyclonal Antibody
AP50113PU-N 400 µL

GPAT4 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TTC34 (C-term) Rabbit Polyclonal Antibody
AP54397PU-N 400 µL

TTC34 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details