Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 25-1 (TVBY1), Biotinylated

This Recombinant Human T cell receptor beta variable 25-1 (TVBY1), Biotinylated spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 25-1 TRBV25-1

UniProt

A0A075B6N4

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

DIYQTPRYLVIGTGKKITLECSQTMGHDKMYWYQQDPGMELHLIHYSYGVNSTEKGDLSSESTVSRIRTEHFPLTLESARPSHTSQYLCASSE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ADAM9 Rabbit mAb
E2R90058 100 µL

ADAM9 Rabbit mAb

Sign In for Pricing
View Details
Mouse Anti-Ovalbumin (Gal d 2) IgG2a ELISA Kit, 96 tests, Quantitative
600-120-O2A 1 Kit

Mouse Anti-Ovalbumin (Gal d 2) IgG2a ELISA Kit, 96 tests, Quantitative

Sign In for Pricing
View Details
PSMF1 AAV siRNA Pooled Vector
38022161 1.0 µg

PSMF1 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
KDEL Polyclonal Antibody, AbBy Fluor™ 750 Conjugated
bs-6940R-BF750 100 µL

KDEL Polyclonal Antibody, AbBy Fluor™ 750 Conjugated

Sign In for Pricing
View Details
Human STRIP1 Pre-designed siRNA Set B
SI015978B 1 Each

Human STRIP1 Pre-designed siRNA Set B

Sign In for Pricing
View Details
Human DNAAF2 qPCR Primer Pair
QH44301S 200 Tests

Human DNAAF2 qPCR Primer Pair

Sign In for Pricing
View Details