Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin kappa variable 2D-29 (KVD29), Biotinylated

This Recombinant Human Immunoglobulin kappa variable 2D-29 (KVD29), Biotinylated spans the amino acid sequence from region 21-120. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin kappa variable 2D-29 IGKV2D-29

UniProt

A0A075B6S2

Expression Region

21-120

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

DIVMTQTPLSLSVTPGQPASISCKSSQSLLHSDGKTYLYWYLQKPGQPPQLLIYEVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQSIQLP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Mouse ASXL1 (KIAA0978), Rabbit Polyclonal
MKA0978 Inquire

Anti-Mouse ASXL1 (KIAA0978), Rabbit Polyclonal

Sign In for Pricing
View Details
HECTD2 (NM_182765) Human Tagged ORF Clone
RC207254 10 µg

HECTD2 (NM_182765) Human Tagged ORF Clone

Sign In for Pricing
View Details
Bpifa3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)
K7607006 1.0 µg DNA

Bpifa3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
ABCA4 Polyclonal Antibody, PE Conjugated
bs-11356R-PE 100 µL

ABCA4 Polyclonal Antibody, PE Conjugated

Sign In for Pricing
View Details
Rabbit Anti-Guinea Pig IgG (H&L) - Cy7
CSA4619-01 100 µL

Rabbit Anti-Guinea Pig IgG (H&L) - Cy7

Sign In for Pricing
View Details
Rabbit Anti-Guinea Pig IgG (H&L) - Cy7
CSA4619-02 500 μL

Rabbit Anti-Guinea Pig IgG (H&L) - Cy7

Sign In for Pricing
View Details