Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin kappa variable 2D-29 (KVD29), Biotinylated

This Recombinant Human Immunoglobulin kappa variable 2D-29 (KVD29), Biotinylated spans the amino acid sequence from region 21-120. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin kappa variable 2D-29 IGKV2D-29

UniProt

A0A075B6S2

Expression Region

21-120

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

DIVMTQTPLSLSVTPGQPASISCKSSQSLLHSDGKTYLYWYLQKPGQPPQLLIYEVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQSIQLP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1000 ug/mL Mesotrione in HPLC Acetonitrile - 1ML
LCS-5044 1 mL

1000 ug/mL Mesotrione in HPLC Acetonitrile - 1ML

Sign In for Pricing
View Details
Ipo5 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
25031114 3x 1.0 µg

Ipo5 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
Recombinant Novosphingobium aromaticivorans Na (+)/H (+) antiporter nhaA 1 (nhaA1), partial
MBS7076577 Inquire

Recombinant Novosphingobium aromaticivorans Na (+)/H (+) antiporter nhaA 1 (nhaA1), partial

Sign In for Pricing
View Details
DNASE2 antibody
70R-16898 50 μL

DNASE2 antibody

Sign In for Pricing
View Details
Lamin B2 (h) -PR
sc-61885-PR 10 µM - 20 µL

Lamin B2 (h) -PR

Sign In for Pricing
View Details
Gp120 Polyclonal Antibody
orb3151635-01 50 µg

Gp120 Polyclonal Antibody

Sign In for Pricing
View Details