Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin kappa variable 1D-17 (KVD17), Biotinylated

This Recombinant Human Immunoglobulin kappa variable 1D-17 (KVD17), Biotinylated spans the amino acid sequence from region 23-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin kappa variable 1D-17 IGKV1D-17

UniProt

A0A075B6S4

Expression Region

23-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

NIQMTQSPSAMSASVGDRVTITCRARQGISNYLAWFQQKPGKVPKHLIYAASSLQSGVPSRFSGSGSGTEFTLTISSLQPEDFATYYCLQHNSYP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MLKL Rabbit Polyclonal Antibody
TA378561 100 µL

MLKL Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Renal pelvis
CS627956 5x 5 µm

Frozen Tissue Sections, Renal pelvis

Sign In for Pricing
View Details
Fibronectin (FN1) Mouse Monoclonal Antibody [Clone ID: SPM246]
AM50112PU-T 20 µg

Fibronectin (FN1) Mouse Monoclonal Antibody [Clone ID: SPM246]

Sign In for Pricing
View Details
Frozen Tissue Sections, Ovary: left
CS500660 5x 5 µm

Frozen Tissue Sections, Ovary: left

Sign In for Pricing
View Details
KIRREL2 (NM_032123) Human Recombinant Protein
TP760905 50 µg

KIRREL2 (NM_032123) Human Recombinant Protein

Sign In for Pricing
View Details
SOS2 Human Gene Knockout Kit (CRISPR)
KN418160 1 Kit

SOS2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details