Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin kappa variable 1-27 (KV127), Biotinylated

This Recombinant Human Immunoglobulin kappa variable 1-27 (KV127), Biotinylated spans the amino acid sequence from region 23-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin kappa variable 1-27 IGKV1-27

UniProt

A0A075B6S5

Expression Region

23-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

DIQMTQSPSSLSASVGDRVTITCRASQGISNYLAWYQQKPGKVPKLLIYAASTLQSGVPSRFSGSGSGTDFTLTISSLQPEDVATYYCQKYNSAP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SIRT7 ELISA Kit (Bovine) (OKEH07732)
OKEH07732 96 Well

SIRT7 ELISA Kit (Bovine) (OKEH07732)

Sign In for Pricing
View Details
PDIA6 (Protein Disulfide-isomerase A6, Protein Disulfide Isomerase P5, Thioredoxin Domain-containing Protein 7, Endoplasmic Reticulum Protein 5, ER Protein 5, ERp5, TXNDC7)
131087 50 µg

PDIA6 (Protein Disulfide-isomerase A6, Protein Disulfide Isomerase P5, Thioredoxin Domain-containing Protein 7, Endoplasmic Reticulum Protein 5, ER Protein 5, ERp5, TXNDC7)

Sign In for Pricing
View Details
TRPV1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K2536907 1.0 µg DNA

TRPV1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
SLC16A6 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K2169508 1.0 µg DNA

SLC16A6 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Human Glucose 6 Phosphate Isomerase (GPI) ELISA Kit
RDR-AMF-Hu-01 96 Tests

Human Glucose 6 Phosphate Isomerase (GPI) ELISA Kit

Sign In for Pricing
View Details
Human Glucose 6 Phosphate Isomerase (GPI) ELISA Kit
RDR-AMF-Hu-02 48 Tests

Human Glucose 6 Phosphate Isomerase (GPI) ELISA Kit

Sign In for Pricing
View Details