Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional immunoglobulinn kappa variable 1-37 (KV137), Biotinylated

This Recombinant Human Probable non-functional immunoglobulinn kappa variable 1-37 (KV137), Biotinylated spans the amino acid sequence from region 23-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional immunoglobulinn kappa variable 1-37 IGKV1-37

UniProt

A0A075B6S9

Expression Region

23-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

DIQLTQSPSSLSASVGDRVTITCRVSQGISSYLNWYRQKPGKVPKLLIYSASNLQSGVPSRFSGSGSGTDFTLTISSLQPEDVATYYGQRTYNAP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C17orf80 Rabbit Polyclonal Antibody (Biotin)
orb2115802 100 µL

C17orf80 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
Cux2 Rabbit Polyclonal Antibody
orb580140 100 µL

Cux2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
1- (3-methoxy-5- (trifluoromethyl) phenyl) propan-1-ol
PC1021161-01 250 mg

1- (3-methoxy-5- (trifluoromethyl) phenyl) propan-1-ol

Sign In for Pricing
View Details
1- (3-methoxy-5- (trifluoromethyl) phenyl) propan-1-ol
PC1021161-02 500 mg

1- (3-methoxy-5- (trifluoromethyl) phenyl) propan-1-ol

Sign In for Pricing
View Details
1- (3-methoxy-5- (trifluoromethyl) phenyl) propan-1-ol
PC1021161-03 1 g

1- (3-methoxy-5- (trifluoromethyl) phenyl) propan-1-ol

Sign In for Pricing
View Details
Alexa Fluor® 647 anti-mouse CD301a (mgL1)
E16FMK301a-025U 25 µg

Alexa Fluor® 647 anti-mouse CD301a (mgL1)

Sign In for Pricing
View Details