Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 12-2 (TVAL2), Biotinylated

This Recombinant Human T cell receptor alpha variable 12-2 (TVAL2), Biotinylated spans the amino acid sequence from region 21-113. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 12-2 TRAV12-2

UniProt

A0A075B6T6

Expression Region

21-113

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QQKEVEQNSGPLSVPEGAIASLNCTYSDRGSQSFFWYRQYSGKSPELIMFIYSNGDKEDGRFTAQLNKASQYVSLLIRDSQPSDSATYLCAVN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chicken Collagen autoantibody ELISA Kit
GTR10395869 96 Well

Chicken Collagen autoantibody ELISA Kit

Sign In for Pricing
View Details
Mcpt1 Mouse qPCR Primer Pair (NM_008570)
MP207866 200 Reactions

Mcpt1 Mouse qPCR Primer Pair (NM_008570)

Sign In for Pricing
View Details
ARO3 Antibody
orb844519 2 mg

ARO3 Antibody

Sign In for Pricing
View Details
Anti-HIF- alpha antibody
STJ97168 200 µl

Anti-HIF- alpha antibody

Sign In for Pricing
View Details
HEK293T-LILRB2 (1) Overexpressing Cell Line
RG-1060 5x 10^6

HEK293T-LILRB2 (1) Overexpressing Cell Line

Sign In for Pricing
View Details
BPV-1 E2 tag (GVSSTSSDFRDR) Mouse Monoclonal Antibody [Clone ID: 3F12]
AM26100PU-N 100 µg

BPV-1 E2 tag (GVSSTSSDFRDR) Mouse Monoclonal Antibody [Clone ID: 3F12]

Sign In for Pricing
View Details