Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 6 (TVA6), Biotinylated

This Recombinant Human T cell receptor alpha variable 6 (TVA6), Biotinylated spans the amino acid sequence from region 41-132. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 6 TRAV6 TCRAV5S1

UniProt

A0A075B6T7

Expression Region

41-132

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QKIEQNSEALNIQEGKTATLTCNYTNYSPAYLQWYRQDPGRGPVFLLLIRENEKEKRKERLKVTFDTTLKQSLFHITASQPADSATYLCALD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FAT1 CRISPR Activation Plasmid (h)
sc-410778-ACT 20 µg

FAT1 CRISPR Activation Plasmid (h)

Sign In for Pricing
View Details
Anthrax Protective Antigen Mouse mAb
MBS9525420-01 0.04 mL

Anthrax Protective Antigen Mouse mAb

Sign In for Pricing
View Details
Anthrax Protective Antigen Mouse mAb
MBS9525420-02 0.1 mL

Anthrax Protective Antigen Mouse mAb

Sign In for Pricing
View Details
Anthrax Protective Antigen Mouse mAb
MBS9525420-03 0.2 mL

Anthrax Protective Antigen Mouse mAb

Sign In for Pricing
View Details
Anthrax Protective Antigen Mouse mAb
MBS9525420-04 5x 0.2 mL

Anthrax Protective Antigen Mouse mAb

Sign In for Pricing
View Details
2-Amino-5-bromopyridine
A18510-01 5 g

2-Amino-5-bromopyridine

Sign In for Pricing
View Details