Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 9-1 (TVA91), Biotinylated

This Recombinant Human T cell receptor alpha variable 9-1 (TVA91), Biotinylated spans the amino acid sequence from region 21-112. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 9-1 TRAV9-1

UniProt

A0A075B6T8

Expression Region

21-112

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

DSVVQTEGQVLPSEGDSLIVNCSYETTQYPSLFWYVQYPGEGPQLHLKAMKANDKGRNKGFEAMYRKETTSFHLEKDSVQESDSAVYFCALS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P130Cas (Cas for Crk-associated substrate, BCAR1, K-associated Substrate, Breast Cancer anti-estrogen Resistance 1 Protein) (BSA & Azide Free) (HRP) discontinued
P1001-97EX-HRP 100 µL

P130Cas (Cas for Crk-associated substrate, BCAR1, K-associated Substrate, Breast Cancer anti-estrogen Resistance 1 Protein) (BSA & Azide Free) (HRP) discontinued

Sign In for Pricing
View Details
Cyclophilin B (PPIB) (NM_000942) Human Recombinant Protein
TP303180 20 µg

Cyclophilin B (PPIB) (NM_000942) Human Recombinant Protein

Sign In for Pricing
View Details
Anti-Chapsyn-110 Antibody
56470-1 100 µg

Anti-Chapsyn-110 Antibody

Sign In for Pricing
View Details
Anti-ARHGEF10 (6G5)
YF-MA20242 100 ug

Anti-ARHGEF10 (6G5)

Sign In for Pricing
View Details
CLEC-18B Lentiviral Activation Particles (h2)
sc-416078-LAC-2 200 µL

CLEC-18B Lentiviral Activation Particles (h2)

Sign In for Pricing
View Details
Map1a Rat shRNA Plasmid (Locus ID 25152)
TL711127 1 Kit

Map1a Rat shRNA Plasmid (Locus ID 25152)

Sign In for Pricing
View Details