Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 7 (TVA7), Biotinylated

This Recombinant Human T cell receptor alpha variable 7 (TVA7), Biotinylated spans the amino acid sequence from region 22-112. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 7 TRAV7

UniProt

A0A075B6U4

Expression Region

22-112

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

ENQVEHSPHFLGPQQGDVASMSCTYSVSRFNNLQWYRQNTGMGPKHLLSMYSAGYEKQKGRLNATLLKNGSSLYITAVQPEDSATYFCAVD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Y12I Antibody
orb829587 2 mg

Y12I Antibody

Sign In for Pricing
View Details
Keratin 31 Double Nickase Plasmid (h)
sc-409641-NIC 20 µg

Keratin 31 Double Nickase Plasmid (h)

Sign In for Pricing
View Details
TFDP2 Protein Vector (Mouse) (pPB-N-His)
PV237811 500 ng

TFDP2 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
Cyclin E1 (Cyclin-E1) (Biotin)
301337-Biotin 100 µL

Cyclin E1 (Cyclin-E1) (Biotin)

Sign In for Pricing
View Details
Hoxa5, CT (Hoxa5, Hox-1.3, Hoxa-5, Homeobox protein Hox-A5, Homeobox protein Hox-1.3) (FITC)
MBS6307740-01 0.2 mL

Hoxa5, CT (Hoxa5, Hox-1.3, Hoxa-5, Homeobox protein Hox-A5, Homeobox protein Hox-1.3) (FITC)

Sign In for Pricing
View Details
Hoxa5, CT (Hoxa5, Hox-1.3, Hoxa-5, Homeobox protein Hox-A5, Homeobox protein Hox-1.3) (FITC)
MBS6307740-02 5x 0.2 mL

Hoxa5, CT (Hoxa5, Hox-1.3, Hoxa-5, Homeobox protein Hox-A5, Homeobox protein Hox-1.3) (FITC)

Sign In for Pricing
View Details