Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 7 (TVA7), Biotinylated

This Recombinant Human T cell receptor alpha variable 7 (TVA7), Biotinylated spans the amino acid sequence from region 22-112. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 7 TRAV7

UniProt

A0A075B6U4

Expression Region

22-112

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

ENQVEHSPHFLGPQQGDVASMSCTYSVSRFNNLQWYRQNTGMGPKHLLSMYSAGYEKQKGRLNATLLKNGSSLYITAVQPEDSATYFCAVD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

pSV40-Tdrp-m Plasmid
PVT11662 2 µg

pSV40-Tdrp-m Plasmid

Sign In for Pricing
View Details
Pescadillo (PES1) Human shRNA Plasmid Kit (Locus ID 23481)
TR310502 1 Kit

Pescadillo (PES1) Human shRNA Plasmid Kit (Locus ID 23481)

Sign In for Pricing
View Details
Mouse Monoclonal Serum Amyloid A1/A2 Antibody (SAA/326) [DyLight 594]
NBP3-08412DL594 100 µL

Mouse Monoclonal Serum Amyloid A1/A2 Antibody (SAA/326) [DyLight 594]

Sign In for Pricing
View Details
GGTLC2 Polyclonal Antibody, AbBy Fluor™ 680 Conjugated
bs-13353R-BF680 100 µL

GGTLC2 Polyclonal Antibody, AbBy Fluor™ 680 Conjugated

Sign In for Pricing
View Details
CKMB (Creatine Kinase-MB Isoenzyme, CK-MB) (FITC)
226879-FITC 100 µL

CKMB (Creatine Kinase-MB Isoenzyme, CK-MB) (FITC)

Sign In for Pricing
View Details
C1 Inactivator Rabbit Polyclonal Antibody (PE-Cy5)
orb875044 100 µL

C1 Inactivator Rabbit Polyclonal Antibody (PE-Cy5)

Sign In for Pricing
View Details