Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 7 (TVA7), Biotinylated

This Recombinant Human T cell receptor alpha variable 7 (TVA7), Biotinylated spans the amino acid sequence from region 22-112. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 7 TRAV7

UniProt

A0A075B6U4

Expression Region

22-112

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

ENQVEHSPHFLGPQQGDVASMSCTYSVSRFNNLQWYRQNTGMGPKHLLSMYSAGYEKQKGRLNATLLKNGSSLYITAVQPEDSATYFCAVD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

POET6 BacMAM transfer plasmid
200107 10 µg

POET6 BacMAM transfer plasmid

Sign In for Pricing
View Details
Human Glycodelin ELISA Kit
SL3321Hu-01 96 Tests

Human Glycodelin ELISA Kit

Sign In for Pricing
View Details
Human Glycodelin ELISA Kit
SL3321Hu-02 48 Tests

Human Glycodelin ELISA Kit

Sign In for Pricing
View Details
Human DSG3/Desmoglein-3 ELISA Kit
E2769Hu 96 Tests

Human DSG3/Desmoglein-3 ELISA Kit

Sign In for Pricing
View Details
FADD Rabbit pAb, BF700 conjugated
orb2851241 100 µL

FADD Rabbit pAb, BF700 conjugated

Sign In for Pricing
View Details
Mouse ACP2 ELISA Kit
E042471 1 Each

Mouse ACP2 ELISA Kit

Sign In for Pricing
View Details