Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 7 (TVA7), Biotinylated

This Recombinant Human T cell receptor alpha variable 7 (TVA7), Biotinylated spans the amino acid sequence from region 22-112. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 7 TRAV7

UniProt

A0A075B6U4

Expression Region

22-112

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

ENQVEHSPHFLGPQQGDVASMSCTYSVSRFNNLQWYRQNTGMGPKHLLSMYSAGYEKQKGRLNATLLKNGSSLYITAVQPEDSATYFCAVD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

5-HT Polyclonal Antibody, Biotin Conjugated
bs-1126R-Biotin-01 20 µL

5-HT Polyclonal Antibody, Biotin Conjugated

Sign In for Pricing
View Details
5-HT Polyclonal Antibody, Biotin Conjugated
bs-1126R-Biotin-02 100 µL

5-HT Polyclonal Antibody, Biotin Conjugated

Sign In for Pricing
View Details
FosB (Phospho-Ser27) Antibody
MBS9502760-01 0.05 mL

FosB (Phospho-Ser27) Antibody

Sign In for Pricing
View Details
FosB (Phospho-Ser27) Antibody
MBS9502760-02 0.1 mL

FosB (Phospho-Ser27) Antibody

Sign In for Pricing
View Details
FosB (Phospho-Ser27) Antibody
MBS9502760-03 5x 0.1 mL

FosB (Phospho-Ser27) Antibody

Sign In for Pricing
View Details
XPNPEP1 Rabbit pAb
E2852182 100 µL

XPNPEP1 Rabbit pAb

Sign In for Pricing
View Details