Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 36/delta variable 7 (TVA36), Biotinylated

This Recombinant Human T cell receptor alpha variable 36/delta variable 7 (TVA36), Biotinylated spans the amino acid sequence from region 22-113. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 36/delta variable 7 TRAV36DV7

UniProt

A0A075B6V5

Expression Region

22-113

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EDKVVQSPLSLVVHEGDTVTLNCSYEVTNFRSLLWYKQEKKAPTFLFMLTSSGIEKKSGRLSSILDKKELFSILNITATQTGDSAIYLCAVE

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CH5424802
TRC-C183360-250MG 250 mg

CH5424802

Sign In for Pricing
View Details
Olr556 (NM_001000929) Rat Untagged Clone
RN200976 10 µg

Olr556 (NM_001000929) Rat Untagged Clone

Sign In for Pricing
View Details
SUCLA2 Lentiviral Activation Particles (m2)
sc-423214-LAC-2 200 µL

SUCLA2 Lentiviral Activation Particles (m2)

Sign In for Pricing
View Details
Recombinant Human CD284/TLR4 Protein, N-His
HT205012-01 50 µg

Recombinant Human CD284/TLR4 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human CD284/TLR4 Protein, N-His
HT205012-02 100 µg

Recombinant Human CD284/TLR4 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human CD284/TLR4 Protein, N-His
HT205012-03 1 mg

Recombinant Human CD284/TLR4 Protein, N-His

Sign In for Pricing
View Details