Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 36/delta variable 7 (TVA36), Biotinylated

This Recombinant Human T cell receptor alpha variable 36/delta variable 7 (TVA36), Biotinylated spans the amino acid sequence from region 22-113. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 36/delta variable 7 TRAV36DV7

UniProt

A0A075B6V5

Expression Region

22-113

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EDKVVQSPLSLVVHEGDTVTLNCSYEVTNFRSLLWYKQEKKAPTFLFMLTSSGIEKKSGRLSSILDKKELFSILNITATQTGDSAIYLCAVE

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human GRG (Groucho homolog) Protein
NBP1-51027-0.25mg 0.25 mg

Recombinant Human GRG (Groucho homolog) Protein

Sign In for Pricing
View Details
Human LACRT protein
orb392047-01 10 µg

Human LACRT protein

Sign In for Pricing
View Details
Human LACRT protein
orb392047-02 50 µg

Human LACRT protein

Sign In for Pricing
View Details
Human LACRT protein
orb392047-03 500 µg

Human LACRT protein

Sign In for Pricing
View Details
Mouse Major urinary protein 20 ELISA Kit
orb1659815 96 Tests

Mouse Major urinary protein 20 ELISA Kit

Sign In for Pricing
View Details
Polyclonal GRM2 / MGLUR2 Antibody (N-Terminus)
APR12291G 0.05mg

Polyclonal GRM2 / MGLUR2 Antibody (N-Terminus)

Sign In for Pricing
View Details