Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 18 (TVA18), Biotinylated

This Recombinant Human T cell receptor alpha variable 18 (TVA18), Biotinylated spans the amino acid sequence from region 21-111. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 18 TRAV18

UniProt

A0A075B6X5

Expression Region

21-111

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

DSVTQTEGPVTLPERAALTLNCTYQSSYSTFLFWYVQYLNKEPELLLKSSENQETDSRGFQASPIKSDSSFHLEKPSVQLSDSAVYYCALR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Apc11 (ANAPC11) (NM_001002247) Human Over-expression Lysate
LC424184 20 µg

Apc11 (ANAPC11) (NM_001002247) Human Over-expression Lysate

Sign In for Pricing
View Details
(2R,3R)-2-Ethyl-1,3-hexanediol
TRC-E193240-500MG 500 mg

(2R,3R)-2-Ethyl-1,3-hexanediol

Sign In for Pricing
View Details
VCX3B Human Gene Knockout Kit (CRISPR)
KN418667 1 Kit

VCX3B Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant Human BLNK/Ly-57 Protein (His Tag)
PKSH030792 50 µg

Recombinant Human BLNK/Ly-57 Protein (His Tag)

Sign In for Pricing
View Details
Vertical Autoclave BAVT-303-B
BAVT-303-B 1 Unit

Vertical Autoclave BAVT-303-B

Sign In for Pricing
View Details
Purified Anti-Mouse IL-2 Antibody[JES6-5H4]
E-AB-F1201A-01 25 µg

Purified Anti-Mouse IL-2 Antibody[JES6-5H4]

Sign In for Pricing
View Details