Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Putative aquaporin-7B (AQP7B), partial, Biotinylated

This Recombinant Human Putative aquaporin-7B (AQP7B), partial, Biotinylated spans the amino acid sequence from region 137-174. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Putative aquaporin-7B AQP7B

UniProt

A0A075B734

Expression Region

137-174

Origin

Homo sapiens (Human)

Field of Research

Kidney & Urological Research

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

LFYTAILHFSGGELMVTGPFATAGIFATYLPDHMTLWR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC25A26 Antibody
A56927-50UL 50 μL

SLC25A26 Antibody

Sign In for Pricing
View Details
AKR1B10 Blocking Peptide
33R-6669 0.1 mg

AKR1B10 Blocking Peptide

Sign In for Pricing
View Details
TCEA1 Antibody
E51A11669 100 µL

TCEA1 Antibody

Sign In for Pricing
View Details
TNFRSF8 Recombinant Protein C-His Tag Lyophilized 10ug
IHUTNFRSF8RCHISLY10UG 10 µg

TNFRSF8 Recombinant Protein C-His Tag Lyophilized 10ug

Sign In for Pricing
View Details
MOG peptides pool
SB286-60NM 60 nmoL

MOG peptides pool

Sign In for Pricing
View Details
SPARC Rabbit pAb (APR21049N)
APR21049N-01 50 µL

SPARC Rabbit pAb (APR21049N)

Sign In for Pricing
View Details