Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin lambda variable 5-45 (LV545), Biotinylated

This Recombinant Human Immunoglobulin lambda variable 5-45 (LV545), Biotinylated spans the amino acid sequence from region 20-123. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin lambda variable 5-45 IGLV5-45

UniProt

A0A087WSX0

Expression Region

20-123

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QAVLTQPSSLSASPGASASLTCTLCSGINVGTYRIYWYQQKPGSPPQYLLRYKSDSDKQQGSGVPSRFSGSKDASANAGILLISGLQSEDEADYYCMIWHSSAS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sheep AT rich interactive domain containing protein 2 (ARID2) ELISA kit
GTR10427963 96 Well

Sheep AT rich interactive domain containing protein 2 (ARID2) ELISA kit

Sign In for Pricing
View Details
Peroxiredoxin 5 Rabbit mAb Antibody
orb3015016 100 µL

Peroxiredoxin 5 Rabbit mAb Antibody

Sign In for Pricing
View Details
Hes1 Rabbit Polyclonal Antibody
TA362908 100 µL

Hes1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
FLOT2, CT (Flotillin 2, Epidermal Surface Antigen, ESA, Membrane Component Chromosome 17 Surface Marker 1, ESA1, M17S1) discontinued
F4568-02B 50 µg

FLOT2, CT (Flotillin 2, Epidermal Surface Antigen, ESA, Membrane Component Chromosome 17 Surface Marker 1, ESA1, M17S1) discontinued

Sign In for Pricing
View Details
ML-297, GIRK activator
TBI1469-25MG 25 mg

ML-297, GIRK activator

Sign In for Pricing
View Details
Ffar1 (NM_194057) Mouse Tagged ORF Clone Lentiviral Particle
MR222997L3V 200 µL

Ffar1 (NM_194057) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details