Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin lambda variable 5-45 (LV545), Biotinylated

This Recombinant Human Immunoglobulin lambda variable 5-45 (LV545), Biotinylated spans the amino acid sequence from region 20-123. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin lambda variable 5-45 IGLV5-45

UniProt

A0A087WSX0

Expression Region

20-123

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QAVLTQPSSLSASPGASASLTCTLCSGINVGTYRIYWYQQKPGSPPQYLLRYKSDSDKQQGSGVPSRFSGSKDASANAGILLISGLQSEDEADYYCMIWHSSAS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Carbonyl Reductase [NADPH] 1 (CBR1) Bovine ELISA Kit
C1296 96 Tests

Carbonyl Reductase [NADPH] 1 (CBR1) Bovine ELISA Kit

Sign In for Pricing
View Details
Blotto/Antifoam in PBS
40220032-2 500 mL

Blotto/Antifoam in PBS

Sign In for Pricing
View Details
Rabbit Anti-Bovine IgG (H&L) - AcalephFluor532
CSA3312-01 100 µL

Rabbit Anti-Bovine IgG (H&L) - AcalephFluor532

Sign In for Pricing
View Details
Rabbit Anti-Bovine IgG (H&L) - AcalephFluor532
CSA3312-02 500 μL

Rabbit Anti-Bovine IgG (H&L) - AcalephFluor532

Sign In for Pricing
View Details
Rabbit Anti-Bovine IgG (H&L) - AcalephFluor532
CSA3312-03 1 mL

Rabbit Anti-Bovine IgG (H&L) - AcalephFluor532

Sign In for Pricing
View Details
Mouse Histone Deacetylase 6 (HDAC6) ELISA Kit
orb780901-01 48 Tests

Mouse Histone Deacetylase 6 (HDAC6) ELISA Kit

Sign In for Pricing
View Details