Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 4-30-2 (HV432), Biotinylated

This Recombinant Human Immunoglobulin heavy variable 4-30-2 (HV432), Biotinylated spans the amino acid sequence from region 20-118. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 4-30-2 IGHV4-30-2

UniProt

A0A087WSY4

Expression Region

20-118

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QLQLQESGSGLVKPSQTLSLTCAVSGGSISSGGYSWSWIRQPPGKGLEWIGYIYHSGSTYYNPSLKSRVTISVDRSKNQFSLKLSSVTAADTAVYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LINC02693 (NM_001113434) Human Over-expression Lysate
LY426413 100 µg

LINC02693 (NM_001113434) Human Over-expression Lysate

Sign In for Pricing
View Details
Muscle Specific Actin (HHF35), CF405S conjugate, 0.1mg/mL
BNC040445-500 1x 500 µL

Muscle Specific Actin (HHF35), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CCL25 Antibody
KC-18470-01 50 μL

CCL25 Antibody

Sign In for Pricing
View Details
CCL25 Antibody
KC-18470-02 100 µL

CCL25 Antibody

Sign In for Pricing
View Details
CCL25 Antibody
KC-18470-03 1 mL

CCL25 Antibody

Sign In for Pricing
View Details
Annexin A1 (ANXA1) (324-337) Goat Polyclonal Antibody
AP22515PU-N 50 µg

Annexin A1 (ANXA1) (324-337) Goat Polyclonal Antibody

Sign In for Pricing
View Details