Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 4-30-2 (HV432), Biotinylated

This Recombinant Human Immunoglobulin heavy variable 4-30-2 (HV432), Biotinylated spans the amino acid sequence from region 20-118. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 4-30-2 IGHV4-30-2

UniProt

A0A087WSY4

Expression Region

20-118

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QLQLQESGSGLVKPSQTLSLTCAVSGGSISSGGYSWSWIRQPPGKGLEWIGYIYHSGSTYYNPSLKSRVTISVDRSKNQFSLKLSSVTAADTAVYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human ACE2 Protein (Fc Tag)
PKSH031870-01 20 µg

Recombinant Human ACE2 Protein (Fc Tag)

Sign In for Pricing
View Details
Recombinant Human ACE2 Protein (Fc Tag)
PKSH031870-02 100 µg

Recombinant Human ACE2 Protein (Fc Tag)

Sign In for Pricing
View Details
FGF1 (NM_001144935) Human Recombinant Protein
TP327797L 1 mg

FGF1 (NM_001144935) Human Recombinant Protein

Sign In for Pricing
View Details
Calretinin / Calbindin 2 (Mesothelioma Marker) (CALB2/2602), CF405S conjugate, 0.1mg/mL
BNC042602-500 1x 500 µL

Calretinin / Calbindin 2 (Mesothelioma Marker) (CALB2/2602), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
1-Hydroxy-2-naphthaldehyde
TRC-H949700-500MG 500 mg

1-Hydroxy-2-naphthaldehyde

Sign In for Pricing
View Details
MspA1I, 200U
RE1306 200 U

MspA1I, 200U

Sign In for Pricing
View Details