Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 4-30-2 (HV432), Biotinylated

This Recombinant Human Immunoglobulin heavy variable 4-30-2 (HV432), Biotinylated spans the amino acid sequence from region 20-118. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 4-30-2 IGHV4-30-2

UniProt

A0A087WSY4

Expression Region

20-118

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QLQLQESGSGLVKPSQTLSLTCAVSGGSISSGGYSWSWIRQPPGKGLEWIGYIYHSGSTYYNPSLKSRVTISVDRSKNQFSLKLSSVTAADTAVYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti Human Ikbkap Polyclonal Antibody
CPBT-67642RH 0.1 mg

Rabbit Anti Human Ikbkap Polyclonal Antibody

Sign In for Pricing
View Details
Human ZNF347 activation kit by CRISPRa
GA113644 1 Kit

Human ZNF347 activation kit by CRISPRa

Sign In for Pricing
View Details
Human Haptoglobin Related Protein (HPR) CLIA Kit
MBS2709027-01 24 Strip Well

Human Haptoglobin Related Protein (HPR) CLIA Kit

Sign In for Pricing
View Details
Human Haptoglobin Related Protein (HPR) CLIA Kit
MBS2709027-02 48 Well

Human Haptoglobin Related Protein (HPR) CLIA Kit

Sign In for Pricing
View Details
Human Haptoglobin Related Protein (HPR) CLIA Kit
MBS2709027-03 96 Well

Human Haptoglobin Related Protein (HPR) CLIA Kit

Sign In for Pricing
View Details
Human Haptoglobin Related Protein (HPR) CLIA Kit
MBS2709027-04 5x 96 Well

Human Haptoglobin Related Protein (HPR) CLIA Kit

Sign In for Pricing
View Details